PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_81.160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 409aa    MW: 45045.4 Da    PI: 6.3316
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_81.160genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.11.4e-11267324562
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                                   kr +r   NR +A rs +RK ++++eLe+kv +L++e ++L  +l  l+  +a  +s+
  evm.model.supercontig_81.160 267 KRVKRILANRQSAARSKERKMQYVAELEQKVHTLQSEVTSLSAQLTLLQGDSAGFTSQ 324
                                   899*****************************************99998777766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-18263327IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.266265328IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-11267317No hitNo description
Gene3DG3DSA:1.20.5.1703.5E-12267317No hitNo description
PfamPF001708.9E-10267320IPR004827Basic-leucine zipper domain
CDDcd147032.22E-22268315No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MEGITETGKK LQSSLFPKPD NLDMASYSSS QVILPVRQLS PSPTSDNKRP GIPPTNPKSD  60
TPLGFSAIIQ SSPQLIPISS RRALEKSVSM KENSKVEKPT QFVKQASERK KEGMGDCKSG  120
GEVVNDLLNS YMNLDNIDLL NSSGTEDKDL DSRASETKTN EGENSDDEVE SCLNGNPEKR  180
EGIKIVAGGD IASPTRHYRS FSMDSYMGSF LFGEESLKLS PSKTQNSQQS PANLADGNLP  240
NGEFTKSELK KIMANEKLAE IALSDPKRVK RILANRQSAA RSKERKMQYV AELEQKVHTL  300
QSEVTSLSAQ LTLLQGDSAG FTSQNNELKF HLQAMEQEAQ LKDALNEALA TEVQRLKLAT  360
AEFTGKAHLS NCMAQQLSIN HQLFQLCQLH DKRQCQQHNG DSNMHDRE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279287ARSKERKMQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017723.11e-140Basic-leucine zipper transcription factor family protein, putative isoform 1
RefseqXP_010271435.11e-140PREDICTED: probable transcription factor PosF21 isoform X1
RefseqXP_010271436.11e-140PREDICTED: probable transcription factor PosF21 isoform X1
TrEMBLA0A061FDF41e-140A0A061FDF4_THECC; Basic-leucine zipper transcription factor family protein, putative isoform 1
STRINGVIT_03s0038g00860.t011e-136(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-95bZIP family protein